PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr037666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 256aa    MW: 28108.4 Da    PI: 8.2247
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr037666.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS134.41.3e-41582431182
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  +++lL++c++a+++++ + aq++L+ l+++a ++gd+++Rl+  f++AL ar ar   + yk+ pp++ ++ +s ++l++   + +++ +++f++ +a
  Pbr037666.1  58 MKQLLVHCVNAIETNNSTVAQQILCVLNNIAPQEGDSNRRLTCAFLRALIARAAR--IGSYKSSPPWPIPKPTSPSTLTSSPSLIDLTSWHRFGFAAA 153
                  579****************************************************..78899999**999999************************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvlv 182
                  N aIleav+g   vHi+D+++++++Q p+L +a+a+R     +pp l++T+ g +e +      ++ee+g++L +fA++ ++ +ef+v+ 
  Pbr037666.1 154 NAAILEAVQGYYVVHIVDLSLTHCMQIPTLVDAIAKRHdgnVSPPLLKLTVAGTMEDVppmLDLSYEELGSKLVNFARSRNIILEFRVIP 243
                  **************************************655569**********998898888999*********************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.50632255IPR005202Transcription factor GRAS
PfamPF035144.3E-3958243IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MMQFTETPPP PLHEIITTPY SNNLPIMMNK NQTHRTRPWP GFPTSKSLGT NFGDANCMKQ  60
LLVHCVNAIE TNNSTVAQQI LCVLNNIAPQ EGDSNRRLTC AFLRALIARA ARIGSYKSSP  120
PWPIPKPTSP STLTSSPSLI DLTSWHRFGF AAANAAILEA VQGYYVVHIV DLSLTHCMQI  180
PTLVDAIAKR HDGNVSPPLL KLTVAGTMED VPPMLDLSYE ELGSKLVNFA RSRNIILEFR  240
VIPSSYIDGF ANLIQ*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009379313.11e-152PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-75SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM5VYZ61e-139M5VYZ6_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g00340.t011e-119(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.13e-66GRAS family protein